Category : Windows 3.X Files
Archive   : WINCHE14.ZIP
Filename : WCHEM.HLP

 
Output of file : WCHEM.HLP contained in archive : WINCHE14.ZIP
?_“ÿÿÿÿ(Eƒzòæéìïõý"'*.5:@CGLRZbgow€…Œ“–œ ¤ª°¾ÃÇËÏÓ×Ýçíûÿ &)07?DPV\bkos}‚”˜Ÿ©¬³·½ÄÉÌÏØßåèðôùþ
#),06:?DGMSW`dlr}„Š‘š¡¤«³·½ÁÅÍÑ×Ýâèñõøÿ  $/5<FNT\ahmx|€„ˆŒ‘•™¡¥©­±¹¿ÇÍÖÞåêîôøûþ
")19?FMSZ^enuz€‰•¤«²µ¹¿ÄÊÑÚÞäïóöûÿ $)18@CGKPTZ^dkov"-"- A- C- Plac- Select- The- This window- Use theAtomAtomicAtomsBarBondBondingBondsBottomBoxBox.BoxesButtonCHEMICALCHEMVIEWCheckChemicalClickingClipboardColorControlCrystalDOSDialogEditFileFront,HybridHydrogen BondsIonicIonsLeftLineListMainMakingManipulatiMatterMatter/CrystalMenuMessageModifMoleculeMotioMovingPeriodicPlaPushingRaytracRequiresRightSaving FilesScreenScrollSelectSelectingSizeStepStructuresTableTemperatureTheThisTimeUpdatesUsing LeftVerVersionViewWindowWindowsadjusallandanimationanotherappearareassignedatomatom.atomsattachauthoravailablebondboundboxbuilbuttoncancellchangecodecollicolorcomcombincommoncompconstructcontcontainscornercorrespondscrystalcursordesireddirectiondirectldisdisplaydistancedoesdoubledowndragdraggingediteffectelectremptyenableextensionfileforfor DOSformfourfromgeneratedgraphicshandhavehighlightedhighlyholdinghorizontalhowever,hybridhydrogenimageincludeincreinformationinteintoionsis aitemlargeleftlistlocationmademainmakemenumodelingmodelsmodifiedmodifymolecularmoleculemonitormousemovemovingmustnewnotnumberobjectoptionorbitalsotherplaceplanetspositionpossibleprobabprogramprovidepushedpushingreadreceivereflectedrequirerightrotatescollbarsscreenselectselectedselectiseveralshadingshosizeslidersmallsourcespecifistructuretaketargettemperaturethatthethesetheythisthreetimetogethertopunitusedusingvaluevelocityversionverticalviaviewwhenwhichwillwindowwithwithinwithoutwritwritten/&;)z4t be .HLP.Unÿÿ¤ÿÿÿÿ|CTXOMAPî<|FONT];|Phrases|SYSTEM |TOMAP´:|TOPICø |TTLBTREEù<|TOPICø }+Àë‹FH÷n‹NÑá+ÁH]ÊU‹ìƒìV‹vÄ^
&€xÿ uƒþ~
ÿN‹^‹v
&ƎÌ8&ƒ>”.tÿv ÿv
¸2/Pÿvÿvš¹ƒÄ ëV¸ÿ+FP¸PP¸6/PFúPšÿÿƒÄÇFøë
‹vøÆBú0ÿFø‹vø€zú tíÿv ÿv
FúP¸ ÿÿ‹ÐëøNO87=
¸VPšÿÿ¸Pšÿÿ ötrŽÆ3ÿü&€=te¹¾…¹ó¦t ¹ÿ2Àò®tçëP¹ÿ° ó®O&Š
Òt83À¹ÿ‹ßò®O+û‹Ï‹ûP‹Ä»SWQPšðc‹Ä»S¿Š¹W»SPšô¹[Æ됃>uBÛãQ¹âþY3À£XÙ>XQ¹âþY&X?>X?uÝ>XQ¹âþY@÷X¿¸t3À¢ë
hjjšÿÿ€>t ƒ>u
è*%s¸þÿùÃjhè»h"šÿÿƒ>uèˆë€>ujhÈÅhš’ºèD¸2è]3À££¸Èǃ>t¸È£§ ˜Ãƒ>u舀>tÛãèå$Ãÿ6VšÿÿÀ>tÛã¡£3À:t›Û⣠£ã‰ù ¸45¿Í!@‰ŒEƒÇâóºìžuÅ¿Xŀ>t ºcÁ¾.Á¿[Á¸4%¹Í!@âû‹ÖÍ!@‹×Í!ù ¸4%¿ÅÍ!@ƒÇâôÃ3Ҁ>t(ƒì‹Ü›6Ù7›6Ù/6‹GƒÄ¹‹ØÑèÑèƒãƒûtBâï¡+³ öóÂà˜Ã£¤Ã€€>t€ÌÀÃÏCëPUƒì‹ì›Ùv¸ä»‡F ‰FSÅ^6-l9O*
Chemical for Windows X5*YE¼.³.ÿÿÿÿ ÿÿÿÿ!!!¼ÿÿ8U!8)$€€¾J"‚4€€‚‚‚ÿ/for ›•1.4 7SKy¯Ös Ôuter Mof Ts. ©“a i…¯is presented Ó± is “±S\. bs ©Cby ùone ­to meet ¥. dn of ±¡bs  be simulated by enabling Œ. ‰minimum energy configuration Ãbe found by enabling Minimize Energy. ‰Shade S]hs shades ±)to enhance ±¹dimensional ý(a 256 Ì board is †d). ‰)Ãbe transferred to a yϱ›3¡úing ¡printing.‹y6n of /(for :) Õwas ãin Turbo PROLOG to run under :. ‹aËhas been ported to Borland C++ to run under ›3.1. c8cÀR€¸€‚ቀ‚ቀ‚ቀ‚ቀ‚ቀ‚ቀ‚ቀ‚á‰á€‰á€‰á€‰€‚ቀ‚ቀ‚ቀ‚ቀ‚ቀ‚‚ÿEnergyFI(Crystals)S\Vng ¡bs`ing `ing ±–dnMouseOrdering Žt}ShadingŒ, †š#c#!-šJ•#JF^€€¸€€‚‚€€à%‰€‚‚€€‚‚€€‚ÿ›hemical opens ÛØs: 6, ^, 5¡–. ‰Ù”on Ãbe Oϱٔon ±S]¯¦s at ±¿of ±Ž.—™ s šws ±Smodel as it is being ¾t. ‰y around ·ÙÃbe Ãto [±)Ìly or  ly. An iin ±S]×G±ÑÙ:r.Comment ™
ìs a ?of Îments about actions ¯¨n oin ±—˜. ^s ¯scrolled off ±Ãbe Ðed ϱÍy. An iin ±S]modifies ±Îment Ùso ¯it ךw ±data ¯is being created.7™
ÛØrols ¯©Ãto DZÐ, Š, features ¡set parameters for ±±šwn in ±—˜.0cJ<Jf€€¸€‚€€à#‰€‚‚€€‚‚€€‚‚€€‚ÿ5˜ 
Û¹ys: RED, GREEN, ¡BLUE ¡a Q . ‰±“§in ±Q# }an ±>box ×[±Ÿon ±¹to ±RGB Ìs «to ¯¯ ‰Ífor ±“Ãbe Æd by ]±ys.Y˜  ÙÎmand ±S]Ãbe Ãto DZupper =Ùto ±Y˜. ‹ÙÛ15 Às ¯×be Ãin future Ês of ·x.Zooming —™- Two ys in ±7™©Ãto DZfield of Ñݱ—˜. ‰:r yis for course œtment ¡± eë5Èr yis for fine œtment.Mass/Density ˜ - Enable ±Mass/Density window to í±mass ¡density.„Œ<„)$€€¸€‚€€‚ÿ—Selection ˜ - Enable ±—Selection Ùto DZєon Ó±—™is enlarged to full Ž.0„0!¢Mouse Operation C0 E\€€¸€€‚‚€€‚‚€€‚‚€€‚‚€€‚ÿDouble 1M'Ûãin —™- Displays a i…ÕÃbe ’.Single 1M'Ûãon an ¬, ß]ã- Displays an Information ½giving ±r, mass, name, ¡orbital details of ±“¯ ma Áin ±/½deletes ±“®‘'to ÷an unbound ­to ¥­- “­to «­or T.‘'to ÷a »­to space - Disconnects ±­T. If ±­was ¹to [than one m¬, ]it —ºs ×êconnect Ÿ¸s.‘ 'to ÷a »- Small œtments to ±Aof a »­Ãbe Cby ù±ãݱ“®fd f14€€¸€‚€€€‚€‚‚ÿUsing s'to ÷a b  ‰YÁis Ãto [a T.% f%!…S\`Ì%`Ml€€¸€€‚‚€€‚‚€€‚‚€€‚‚€€‚‚€€‚ÿS] S]¦s at ±¿of ±Ž.Allows Ts to be saved to or ±êk. - Displays a i…Õ©’.–  ±Ðing æ: CBack, r, MTo, or . Also, ‹±Uup, ô, <, or ˆ.6 - Used to DZ†, €, or —~.˜ hanges ±arrangement of Øs on ±Ž.%`%!¸}“E%“Hb€€¸€€‚‚€€à!‰€à"‰€‚‚€€‚‚ÿ}  ±­IEIat ±¿of ±(or óclick ±=YÁÛ±ãin ±ÑØ). A i…קin a =# As ©“°y קin ±Q# Push ±OK Áafter Ÿå±been ’.Make Eor Klicking ±Yon an 9in ±$ or ion ?×add ¯atrribute to ±. ‰PBox Ãbe Oèy, if ä.Repeat  repeat ÁÃbe Ãto duplicate ±previous ”on.(“(!µVng ¦™(²E\€€¸€€€‚‚€‚‚€€‚‚€€‚‚€€‚ÿVon of Atom ¡making bs fter ©“¡ìed in ±—™°y Ãbe manipulated ϱX.g ing ±ãon an ¡±=YÁõב±to be Zd. Move ±ãto ±aswhile õ±YÀ.to ÔüÔGbs - gan to a son ¿of ¥­×bring up a =˜. All uways ³two ±Ãbe »©?in a Q# mOK ×bind ±±Å±“¸.gbs ing ±ãon a c¡the ‰YÁõב±cto be Zd. Move ±ãto ±aswhile õ±YÀ.6ling ±çof  e ±ãon ±side of ±«closest to ±å¹æ. ‰¹in ·ç×be ±in ˜. Some ring ¦s ‡$s Ûa _4, _5 or a _6 ending. ‰¹for ³$s is ±”on ¯×
a ring ¦.Û*²Û26€€¸€‚€€‚‚€€‚‚ÿBreaking an - ga ¸ed more than 1.5 ºs its ¸ing ï×free ±¸.}a b - m±=YÁב±U¯±ãis on. ‰rotation of an individual U†s ¯±Ube ’.3Û3!â`ing how ©šwn¯3¯>N€€¸€‚€‚€€‚‚€€‚‚€€‚‚ÿ`ying how ±©šwnLabeling tom ×be labeled if ±Label -! is d.Ns - Ns ×be d if ±O-!is d. ‰width of ±¹line ßto ±¹d.4ing  EIto o±5™in ±upper =Ýof ±Ž. ‰±“§in ±Q# }an ±>box ×[±Ÿon ±¹to ±RGB Ìs «to ¯atom. ‰Ífor ±“Ãbe Æd by ]±xBars. ‰Ífor Ÿ±of ·type ×be Æd.+¯+!û`ing ±–Ðè+Ð8B€€¸€‚‚€‚‚€€‚‚€€‚‚ÿ`ying ±–Top, , r, L, CBack ing one of ³radio Às in ±7™×DZçfs ©Ðed .Rotate U,D,L,R licking on of ³Às Û±"all" i“׋Ÿgby a ¡angle. ‰"select" i×only ‹±U’.w?!- U±Çin ±wû½ er reduces ±¡Fs ±):r. ˆrefore, ±"+" Á×G±) er, ¡±Á×Git bigger. A aÇÃbe entered èy 3±w? , #±"+' or Á_be }for ±Çto ©ü.5Ð5!«`ying ±EnvironmentE[5Q?P€€¸€‚‚€€‚‚€‚‚€€‚‚€€‚ÿand †¡­©Ãto Q±dynamic motion of ±Ó»is d.,box - Enabling ±checkbox ×cause ±±to Z. ¯Îe close ½×¹½if ¸ing is t.step ? - When is d ±±©ìed at »0rvals ¯©determined ±€. ‰»,mented or decemented ϱ"+" ¡Às next to ±?f›f# ‰»step Ãalso be Æd by direct entry 3±€ , #±"+" or Á_be }for ±aÇto ©ü.‡? hanging ±Çin ±‡?!×DZkinetic energy ×be given Ó°y Êde Û±border or ¥¯ Use ±"+" or Às to DZÆ. %Q%"€€¸€‚ÿ'%'!
motionã'ã>N€€¸€€€‚‚€‚‚€€‚‚€€‚‚ÿdn simulation zs a very simple model of ±Zment of ±¡Ts. [Ûa ɯ,ases Û­¡decreases Ûmass. ¯GØact ×be ¸ed ½if t. When ±hit ±side of ±—™¯©…back. U±—™ er ×,ase ±vility of Êsions.Initial Velocity tom ¡bs ©given an initial ɯßto °ir °rmal Kinetic. EnergyReflection toms ©…off of ±—™walls ¡off of each m( if °y ©c¸ed)- ¯Êde ¸, if t.'ã'!gEnergy@>'@)$€€¸€€‚€‚ÿEnergy - Enable ±Minimize Energy checkbox to randomly search for a lower energy sfor ±°. Each ­is tested to determine if a slight random Zment in ±X, Y, or Z çresults in a lower energy configuration. ‰random step can be œted to speed up or slow done ±search.$@$!&s $;H€€¸€€‚€‚€‚‚ƒ‚‚ƒ‚‚€€‚ÿt Save or Save As i±AI9at ±¿of ±Ž. Two hs are ·to Q± at of ±data ãto ±êk. One ñc+k¡±moutputs an abridged  at ¯only +A..AFormat OptionsExclude Empty Orbitals - ‹iexcludes kÓàing ±.Short Format - ‹iàes a šrtened  at ¯+only ds.Compatibility Û)¡* lthough /for ›Ãs /
, ±Ôatibility does cwork in ±mæ. A aversion of *, Ë2.1 was ãto šw £of Ts ãÛ/for š.((!­ShadingC(' €€¸€‚€‚‚ÿShading‰™iin ±EIadds 3D ™¡shadows to ±T. ‹i†s a Super VGA WÛ256 Ìs. ›_be set to a 256 Ímode in order to use ·h. Also, ·™is very Ôutationally intensive ¡may ©—minutes to draw an image.wƒ#€€ÂJ"‚4€ÿAn iin ±ÐÒ¨™Isaves ±)to ±2. ‹icopies ±Palette to ±3to Dtain Í0grity.,ƒ,!3Hydrogen à#,à("€€¾J"‚4€€‚‚ÿF A '¹is  ed Ótwo ­share a Îmon '¯ One of ±±_be þonegative. ‹¹type Ãbe  ed by ùan ­to meet a '­¯6ttached to a þonegative ­such as Oxygen or Nitrogen.'à'#€€¸€‚‚ÿ#'#!Ø8µµ#µ("€€¸€‚€‚‚‚ÿ8s (Ionic ‚)}±[i±EIìs a =!¯Ãbe Ãto ×3D Mof I‚. I¦s ©¾d by ”ng ±5¯©Ãto ¾d one ÁÄ. ‰of ±ÁÅcan be Æd manually or ±Ãbe Ôuted by ±x. ‰Q%©Ãto ‘±5¯×be Â. ‰Q%on ±=©Ãto ‘±Kfor ±center, Ü, face, ¡edge of ±ÁÄ. ‰Q%on ±‰©Ãto o5at ¤ed @s ݱÄ. ‰@s for ±‰?¼es ©¤ed by filling in ±A¼es above each ?¼. ‰AÇÃrange 0.0 to 1.0 ¡correspond to ±ion AݱÁÄ.After ±5©“¡°ir @s Û±ÁÅ©¤ed, ±of ±ÁÅÃbe approximated by ±À. m±OK Á×í±à. ‰á§Ãbe Oby re-issuing ±[Îmand. ‰Clear Áon ±9=! clears Ÿion ”ons.)
µ)!ÿÿOrder ŽM<)MY„€€¸€‚€€‚‚€€€€‚‚€€€€‚‚€€€€€€‚ÿIn additional to /for š, ±following xs ©¶. All ©for IBM PC ¡Ôatibles.)“4.2 
7SKy¯uses a I”on 0rface. ‹yñc{Ÿof ±features of /for š. ‹y×vly cbe extended past Ë4.2. qa V.CRYSTAL “1.0 
is Ãto ¾d á¦s. English Îmands ©Ãto describe ±¦. ‰easiest way to ¾d a a§is to start Ûa similar ¦. ‰necessary Æs ðn be CÄ ±¾t in úor. qEGA/VGA.* “2.0 
7Ôanion y¯šws 3-dimensional £of ±MÛ(. qEGA or VGA V.M&?P€€¸€‚€€€€€€‚‚€€‚‚‚ÿBIOCHEM “1.0 
Ðes Ts CÛ/3;Ts. ‰²ments Ãbe CÅcovalent, &, ó&, peptide, or ionic ¸ing. @s for Îmon biochemical Ts ©*d. )data s ±.DAT. @s ¯©Ðed ÅBioCHEM ±.BIO. Biochem †s a CGA or EGA ‰$Ö&`$V.PLANETS ’. 4.1 
Ôutes /relating to ±r, î, magnitude, orbit Ð, skyview, etc for ±major p, minor qor Halley's Îet on a ¤ed date ¡º. jnets works ÛCGA, EGA, Hercules, or VGA Vs.All of ³xs ©public domain ¡updates Ãbe obtained ±various Public Domain / Shareware distributors. If you would like to ƒ±latest Ëèy ±µ±price ?is >ed below. Ž, for people that ‚d °ir current ˱µ©half price. Please indicate if you want 3 1/2 or 5 1/4 inch êks.f~&fAT€€¸€‚‚ƒƒƒƒ‚ƒƒƒƒ‚ƒƒƒ‚ƒƒ‚ƒƒƒƒ‚ƒ‚‚‚‚‚‚‚ÿ)for ›ß£È$20)for ›Û£È$30(/CHEMVIEW/CRYSTAL/BioCHEM for :$20 for set(/CHEMVIEW/CRYSTAL/BioChem Û£È$30jnet •4.1 Û Pascal £È$10Overseas shipping (please, check drawn on US bank or cash) $5Larry Puhl6 Plum CourtSleepy Hollow, Ill. 60118!f!!zÿÿÿÿÿÿÿÿYZ!Y!€€¸€ÿA =!7temporary Ù¯¦s on ±to request ¤c input.!Y!!…ÿÿÿÿÿÿÿÿdd!d"€€¸€‚ÿDs ©Ðations of ¬ic k¯define ±æal characteristics of .!d!!‰ÿÿÿÿÿÿÿÿh_!h"€€¸€‚ÿK©¯an þical charge do to ±addition or deletion of an þon.!h!!}ÿÿÿÿÿÿÿÿ\\!\"€€¸€‚ÿA Q!>s ±possible ”ons in a ½Õ±user Ñan 8.!\!!Xÿÿÿÿÿÿÿÿ7"!7"€€¸€‚ÿ ]at ±¿of ±Ž.!7!!ÿÿÿÿÿÿÿÿlˆ!l!€€¸€ÿA y7!or ÍØrol ¯is Ãto DZÇof a variable or [±Øents Ýa Ø. !l!!Fÿÿÿÿÿÿÿÿ%!%"€€¸€‚ÿ!%!!ÿÿÿÿÿÿÿÿ©  Èõ— 
Ô‰kf‚¨U ˆ!`$b+Ü+a,ê,g-¿-L.’.‘ˆ\Helv.atomsattachautTimes New RomanbounSymbollbuttoncancelArialecodecollicoloChicagoincommoncompGenevactcontcontainMonacocorrespondscrZapf DingbatsireddiBookmanirectldisdisN Helvetica NarrowbPalatinogdraggingedZapf ChanceryemptyeTimesxtensionfilefoHelveticarmfourfromCourierdgraphicshanAvant GardehtedhighNew Century Schlbkh

 /&;)LzFont name toÿÿëÿÿÿÿÈWindowsõMouse Operation— Main Menu
Selecting AtomsÔManipulating Atoms‰Modifing how Atoms are shownkModifing the ViewfModifying the EnvironmentmotionEnergy‚files¨ShadingU Hydrogen Bondingˆ!Crystal`$Order Updates¬Ž€`ï3©Ðœ–»ƒlàô_À €¡Å°Å¦Å¬ÅUV‹ìÅvNN‰vljÀ^]ϡŬŦŰÅûPWVRQSƒìU‹ìü‹Ó‹ÇÅ~GG‹Mþ‹ÙÐÃÐÃãÑÃ.ÿ§mŎFë
ŒÛŽÃëŒÓŽÃŒFëW‹ÓŠÙÀëƒãG‹Mþ.ÿ§PÅüPWVRQSU‹ìŒÚ‹ÇÅ~‹
ƒÇ€Á(sώ‹Óë ûPWVRQSU‹ìŒØŽÀü‹Ó‹ÇÅ~G‹Mþ€é4ÐÅÐŊ݃ãÑã.ÿ§°Á‹òët‹ðëp‹vŽFŠ˜Gðëb‹ðvŽFŠ˜GðëR‹ÆЋ‹ðŠ˜GðëB‹vŽF5ƒÇë5‹ðvŽF5ƒÇë%‹ÆЋ‹ð5ƒÇ됋ðvŽFë
‹ðòë‹5GG‰~Š.Ž0¹ˆ¦Ç ÐíÐíÐíÐíŠÝƒãöÁt
¸¤ÇP.ÿ§ÂS‹Ùƒã.ÿ— Â[ŒØŽÀ‹6‹þƒï ‰>–ëR‰~Š3À.‹>0¹ŽßŽÇˆ¦£ŠÝÐëÐëÐëÐëƒãöÁt .ÿ—Â鏐èLr@‰6–öÁt‰>–öÃt€óöÁt.ÿ—ðÁ‹6;6t ƒî ‰6ëWèŽôëò¸¤ÇP.ÿ§ðÁè€ôƒë?‹6‹þŠÕ€âŠòÐæÖ2ö+ú;>øõÃè³ë]ƒÄ[YZ^_é*ø]ƒÄ[YZ^_XÏ¡  öЊ>€Ï€ç?
ÇöЩÿßuÅÿ&§€>¦ÍuȋìÅ~ƒÇ‹Mþ€é4€ùwµ‹F ‹V‹v
ŽFÿZ¥NŠÝƒãÑã.ÿ§°ÁŠ¦€ù›t€ùt€ñ €ùør€‹ìÅ~ë‹ìÅ~GŠ
€ñ €ùørçŠmƒÇ€Á‹F ‹V‹v
ŽFŒVÐÅÐŊ݃ãÑã.ÿ§°Á‹Ùƒã.ÿ§ ‹كã.ÿ§(‹كã.ÿ—(‹6;6vƒî ‰6ÃèUóëó‹Ùƒã.ÿ§0‹كã.ÿ§8Â÷Áuéêé¡÷Át$ñ÷ÁuùtÇ ÃTX;Äuk¡ ‰FÃ÷Át ÷Áué éè÷ÁuéÇ黊ÝÐëƒã.ÿ§@ŠÝÐëƒã.ÿ§PŠÝÐëƒã.ÿ§`Â÷ÁuéP€ñ÷Áu¸éŠöÁt3À逃@к€ë#º€ë3Ò»¸Âë3҇÷»ØÂë3Ò»ØÂë3Ò»˜ÂŠE ÐàÐà
D ˜ÑàØ2u
2T
‹M‹D.ÿ'‹÷ŠÖèQˆU
Ãë‹÷ƒë=¾Ã2ò€æ€èu
þ ÃëꃾË>–.¥.¥.¥.¥.¥.¥ƒï ƒî Ë>–;÷t ¥¥¥¥¥¥ƒï ƒî Ãö tÅ2ÖxÁ놋Ƌ߃ƃǹýó§ür‹ð냋óé~ÿ+Á|‡÷†òÈ÷Ø÷Ø=C~/UR‹u½2Öy÷݋‹M‹]‹} íxé`ƒêƒÙƒÛƒßé‹URQ2֜‹è­‹Ð­‹È­‹Ø­3ö‡î ötpƒþ| ítƒÊ‹ê‹Ñ‹Ë‹Ø3ÀƒîwåtSr)ƒþ|3•
Àt€ÌŠÄŠâ•ŠÖŠñŠÍŠëŠßŠøŠÄ2äƒîwt(ÑåÑÒÑÑÑÓÑÐFuóë‡Î÷Å?tƒÍ ÑèÑÛÑÞÑÚÑÝâô‹Î‹÷‹ø÷Åÿ?tƒÍXx"L\|sÑßÑÛÑÙÑÚÑÝsƒÍ@‹ðé”+L\|s3ö÷×÷Ó÷Ñ÷Ò÷ÝõÖÎÞþ‹ð駋ðX€ô€PéUŠþ2òRÁ@P"ú3ۋë‹Ë‹ Àt ‹ Òt÷â‹è‹ÊU3í‹ Àt‹U Òt ÷âÈڃՋD Àt‹ Òt ÷âÈڃÕX ÁP3ɋ Àt‹U Òt ÷âØêƒÑ‹D Àt‹U Òt ÷âØêƒÑ‹D Àt‹ Òt ÷âØêƒÑX ÃP3ۋ Àt
÷eèʃӋD Àt‹U Òt ÷âèʃӋD À

  3 Responses to “Category : Windows 3.X Files
Archive   : WINCHE14.ZIP
Filename : WCHEM.HLP

  1. Very nice! Thank you for this wonderful archive. I wonder why I found it only now. Long live the BBS file archives!

  2. This is so awesome! 😀 I’d be cool if you could download an entire archive of this at once, though.

  3. But one thing that puzzles me is the “mtswslnkmcjklsdlsbdmMICROSOFT” string. There is an article about it here. It is definitely worth a read: http://www.os2museum.com/wp/mtswslnk/